PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G022000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family B3
Protein Properties Length: 553aa    MW: 62082.6 Da    PI: 10.1985
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G022000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.97.3e-13481123199
                           .--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                    B3  31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                           + ++t  + ++ g++W+v++   + +++ +l++GW eF  a+g+  g fvv++++g  ++ l+vkvf++
  Sobic.006G022000.1.p  48 AAERTALVVSPFGKVWRVEV--GRDGDGAFLGRGWAEFLAAHGVGLGWFVVLRHEG--GGALTVKVFDT 112
                           455689999***********..999999*************************765..7778*****97 PP

2B347.63.1e-151492281295
                           HTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                    B3  12 ksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                           ++  ++lp +f++++  ++  +skt ++ ++ g+ W ++l  ++ ++++++t+GW++F + +g++ gD+++++++g++ f  ++k
  Sobic.006G022000.1.p 149 SE-KMILPARFVKNYvTEECLNSKTAVILSPLGKFWHIEL--KNDKSGMFFTGGWSQFLEFHGICNGDVLLLRYEGNMVF--KFK 228
                           34.49*******999966667999****************..9999999**************************99999..554 PP

3B355.11.3e-17300383186
                           EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldg 86 
                           ++k+ ++ ++l++ +l+l+kkf++ +g    +++tl+ e  s rsW v+     ++g+ y+l++GWk+F+++n+Lk+gD ++F  ++
  Sobic.006G022000.1.p 300 WIKKKINTYALER-LLSLSKKFCNWIGFRFSCTITLKTEIDSTRSWLVRG--AAYKGScYILGEGWKSFCQDNRLKAGDLCTFNIIE 383
                           6789999999998.5********99988866766666666777*******..77777779***********************9765 PP

4B358.21.5e-18459540386
                           EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                    B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                           +++++ ++ ++ rl+l   f++++g+ +++++tl+    s++sW+v   +++k+g y+++ GW++F+++n+Lk+gD+++F +++
  Sobic.006G022000.1.p 459 QKEMNTNSIAR-RLSLAPAFCKKIGLRQRCTITLKTSINSSNSWRVGG-HWQKDGNYTIELGWQKFCRENELKVGDVCTFNVIE 540
                           45556666665.6**************99987777777999******9.7899999************************9775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010197.6E-519113IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.3E-1320114IPR015300DNA-binding pseudobarrel domain
CDDcd100171.35E-820111No hitNo description
SuperFamilySSF1019361.73E-1325115IPR015300DNA-binding pseudobarrel domain
PfamPF023625.2E-1049112IPR003340B3 DNA binding domain
PROSITE profilePS508639.99651113IPR003340B3 DNA binding domain
PROSITE profilePS5086311.899137233IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-17137233IPR015300DNA-binding pseudobarrel domain
CDDcd100179.01E-13138230No hitNo description
SuperFamilySSF1019361.9E-18138235IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.3E-11140233IPR003340B3 DNA binding domain
PfamPF023624.4E-12149227IPR003340B3 DNA binding domain
SuperFamilySSF1019363.14E-17299394IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.8E-8301395IPR003340B3 DNA binding domain
PfamPF023627.2E-13302383IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-17303393IPR015300DNA-binding pseudobarrel domain
CDDcd100172.48E-11314379No hitNo description
PROSITE profilePS5086311.434331395IPR003340B3 DNA binding domain
SuperFamilySSF1019361.92E-16452550IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.616456552IPR003340B3 DNA binding domain
SMARTSM010190.0016458552IPR003340B3 DNA binding domain
CDDcd100171.15E-10458536No hitNo description
Gene3DG3DSA:2.40.330.102.4E-17459549IPR015300DNA-binding pseudobarrel domain
PfamPF023621.4E-14467546IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
MPLPSDPGPR PAAPAMAKQF KVLLPPFHKL RISDELAGCF DAGEGEGAAE RTALVVSPFG  60
KVWRVEVGRD GDGAFLGRGW AEFLAAHGVG LGWFVVLRHE GGGALTVKVF DTSLCIKEFG  120
APAAVMTSRT SKGVICKPQF IRIFHPYLSE KMILPARFVK NYVTEECLNS KTAVILSPLG  180
KFWHIELKND KSGMFFTGGW SQFLEFHGIC NGDVLLLRYE GNMVFKFKAF GLGGCQKDFR  240
HQNAGIQLNT EKRQETHSSI RKRKSNDNKS SSEENKRPKS SVTSPSLKLQ EPYQMGTTSW  300
IKKKINTYAL ERLLSLSKKF CNWIGFRFSC TITLKTEIDS TRSWLVRGAA YKGSCYILGE  360
GWKSFCQDNR LKAGDLCTFN IIETTLWHVT ITRCKHKSTL ADTFKQKKSP CSSSRDHKTN  420
KGSSSSEEAK EPKISMTSLS KVRSFTRCVY DIGPPSWIQK EMNTNSIARR LSLAPAFCKK  480
IGLRQRCTIT LKTSINSSNS WRVGGHWQKD GNYTIELGWQ KFCRENELKV GDVCTFNVIE  540
TKLWHVVITH RH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669670.10.0PREDICTED: putative B3 domain-containing protein Os04g0347400
TrEMBLA0A060D1G20.0A0A060D1G2_MAIZE; ABI3VP1 transcription factor (Fragment)
STRINGSb06g002075.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Representative plantOGRP10106410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31630.12e-13B3 family protein